Domain: criminaldefenselawyerpanamacity.net
Status: Active as of Friday 15th of February 2019 01:34:34 PM
Host IP Address: 184.168.131.241
Host IP Country:
Reverse Lookup : ip-184-168-131-241.ip.secureserver.net

Additional Server Information / Response :
Spider mode enabled. Check if remote file exists.
--2019-02-15 13:34:33--  http://criminaldefenselawyerpanamacity.net/
Resolving criminaldefenselawyerpanamacity.net (criminaldefenselawyerpanamacity.net)... 184.168.131.241
Connecting to criminaldefenselawyerpanamacity.net (criminaldefenselawyerpanamacity.net)|184.168.131.241|:80... connected.
HTTP request sent, awaiting response... Read error (Connection reset by peer) in headers.
Giving up.