Domain: criminaldefenselawyerpanamacity.net
Status: Active as of Monday 17th of December 2018 02:04:29 PM
Host IP Address: 184.168.131.241
Host IP Country:
Reverse Lookup : ip-184-168-131-241.ip.secureserver.net

Additional Server Information / Response :
Spider mode enabled. Check if remote file exists.
--2018-12-17 14:04:29--  http://criminaldefenselawyerpanamacity.net/
Resolving criminaldefenselawyerpanamacity.net (criminaldefenselawyerpanamacity.net)... 184.168.131.241
Connecting to criminaldefenselawyerpanamacity.net (criminaldefenselawyerpanamacity.net)|184.168.131.241|:80... connected.
HTTP request sent, awaiting response... 
  HTTP/1.1 302 Found
  Connection: close
  Pragma: no-cache
  cache-control: no-cache
  Location: /NMoeZ/
Location: /NMoeZ/ [following]
Spider mode enabled. Check if remote file exists.
--2018-12-17 14:04:29--  http://criminaldefenselawyerpanamacity.net/NMoeZ/
Connecting to criminaldefenselawyerpanamacity.net (criminaldefenselawyerpanamacity.net)|184.168.131.241|:80... connected.
HTTP request sent, awaiting response... 
  HTTP/1.1 302 Found
  Connection: close
  Pragma: no-cache
  cache-control: no-cache
  Location: /
Location: / [following]
Spider mode enabled. Check if remote file exists.
--2018-12-17 14:04:29--  http://criminaldefenselawyerpanamacity.net/
Connecting to criminaldefenselawyerpanamacity.net (criminaldefenselawyerpanamacity.net)|184.168.131.241|:80... connected.
HTTP request sent, awaiting response... 
  HTTP/1.1 301 Moved Permanently
  Server: nginx/1.12.2
  Date: Mon, 17 Dec 2018 20:11:17 GMT
  Content-Type: text/html; charset=utf-8
  Connection: close
  Location: http://www.panamacitybeachfloridaattorney.com
Location: http://www.panamacitybeachfloridaattorney.com [following]
Spider mode enabled. Check if remote file exists.
--2018-12-17 14:04:29--  http://www.panamacitybeachfloridaattorney.com/
Resolving www.panamacitybeachfloridaattorney.com (www.panamacitybeachfloridaattorney.com)... 104.16.111.239, 104.16.110.239, 104.16.108.239, ...
Connecting to www.panamacitybeachfloridaattorney.com (www.panamacitybeachfloridaattorney.com)|104.16.111.239|:80... connected.
HTTP request sent, awaiting response... 
  HTTP/1.1 301 Moved Permanently
  Date: Mon, 17 Dec 2018 20:11:17 GMT
  Connection: keep-alive
  Set-Cookie: __cfduid=d7531503e13b0a5f2496be6073d0464f81545077477; expires=Tue, 17-Dec-19 20:11:17 GMT; path=/; domain=.www.panamacitybeachfloridaattorney.com; HttpOnly
  Location: https://www.panamacitybeachfloridaattorney.com/
  Server: cloudflare
  CF-RAY: 48ac09ba26027b06-MCI
Location: https://www.panamacitybeachfloridaattorney.com/ [following]
Spider mode enabled. Check if remote file exists.
--2018-12-17 14:04:29--  https://www.panamacitybeachfloridaattorney.com/
Connecting to www.panamacitybeachfloridaattorney.com (www.panamacitybeachfloridaattorney.com)|104.16.111.239|:443... connected.
HTTP request sent, awaiting response... 
  HTTP/1.1 200 OK
  Date: Mon, 17 Dec 2018 20:11:17 GMT
  Content-Type: text/html
  Connection: keep-alive
  CF-Cache-Status: HIT
  Cache-Control: public, max-age=604800
  CF-RAY: 48ac09ba4c907ae8-MCI
  Content-Security-Policy: upgrade-insecure-requests
  Content-Security-Policy-Report-Only: default-src https: blob: 'unsafe-inline' 'unsafe-eval'; img-src https: data:; report-uri https://firmsites.report-uri.com/r/t/csp/reportOnly
  Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
  FindLaw: FindLaw
  Vary: User-Agent, SSLClientCipher,Accept-Encoding
  X-UA-Compatible: IE=Edge,chrome=1
  Server: cloudflare
Length: unspecified [text/html]
Remote file exists and could contain further links,
but recursion is disabled -- not retrieving.